PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02989.70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YC
Protein Properties Length: 325aa    MW: 34943.2 Da    PI: 4.6059
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02989.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC574.4e-1820952398
          NF-YC 23 larikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                   larikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t+    ++ +v++ ++fdfl div r
  Jcr4S02989.70 20 LARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMSALHLKHCVQSYNVFDFLRDIVSR 95
                   9************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008085.0E-172080IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.4E-242095IPR009072Histone-fold
SuperFamilySSF471131.35E-192796IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MGQIDYVIFN TGAGMWDQDL ARIKKIMQAD EDVGKIALAV PVLVSKALEL FLQDLCDRTY  60
EITLQRGAKT MSALHLKHCV QSYNVFDFLR DIVSRVPDYG HGHSDHSADH RPLQKRKPIG  120
DECNDSDEES KRSRMHETSH AGSSGRGRGR GRGRGRGRGS RNVERESSHR EIESEPSTAL  180
QQSIKVNSNP GIAVDNGSES KELLMEDAVA SDGANASERN FDLNADVIEN EDSKATAAAS  240
AAAAAAAASA SASASATSPS TSTATATAGA AVIDSSAAVP ATDTNREEYP GWSLSEMDKM  300
PFDPLQLAQL GTRLDEEEED YDEEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-1621811575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147157RGRGRGRGRGR
2149158RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2904630.0KF290463.1 Jatropha curcas clone pJcSSR2604 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068734.10.0PREDICTED: dr1-associated corepressor homolog
TrEMBLA0A067L7U30.0A0A067L7U3_JATCU; Uncharacterized protein
STRINGPOPTR_0003s19130.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.14e-61nuclear factor Y, subunit C11